Browsing by Subject "peptide synthesis"
Now showing items 1-10 of 13
-
Comparative evaluation of the synthesis and purification of transmembrane peptide fragments - Rat bradykinin receptor fragment 64-97 as model
(Munksgaard Int Publ Ltd, 1997-04-01)The 34-residue peptide CTVAEIYLGNLAGADLILASGLPFWAITIANNFD (TM-34), corresponding to the 64-97 sequence of the rat bradykinin receptor, was selected as a model of hydrophobic transmembrane peptide segment for systematic ...
-
Comparative investigation of the cleavage step in the synthesis of model peptide resins: Implications for N-alpha-9-fluorenylmethyloxycarbonyl-solid phase peptide synthesis
(Pharmaceutical Soc Japan, 2007-03-01)Based on our studies of the stability of model peptide-resin linkage in acid media, we previously proposed a rule for resin selection and a final cleavage protocol applicable to the N-alpha-tert-butyloxycarbonyl (Boc)-peptide ...
-
Estudos de síntese, conformação e atividade biológica de novos análogos do peptídeo antimicrobiano gomesina
(Universidade Federal de São Paulo (UNIFESP), 2016-08-31)Gomesin (ZCRRLCYKQRCVTYCRGR-NH2) is an antimicrobial peptide isolated from hemocytes of the Brazilian spider Acanfhoscurria gomesiana. The molecule has four cysteines that form two intramolecular disulfide bridges at ...
-
Fluorescent properties of amino acids labeled with ortho-aminobenzoic acid
(Wiley-Blackwell, 1998-01-01)ortho-Aminobenzoic acid (Abz) has been used as a convenient fluorescent donor group in internally quenched fluorescent peptides, which are employed as substrates for several proteolytic enzymes. As Abz is usually bound to ...
-
Importance of the solvation degree of peptide-resin beads for amine groups determination by the picric acid method
(Sociedade Brasileira de Química, 2000-10-01)The classic and important picric acid method used in polymers biochemical and chemical fields of polymers for amine group quantification was chosen in this work as a model for evaluating the influence of the resin bead ...
-
Inhibition of angiotensin converting enzyme and potentiation of bradykinin by retro-inverso analogues of short peptides and sequences related to angiotensin I and bradykinin
(Elsevier B.V., 1996-04-26)There is pharmacological evidence indicating that, in addition to the inhibition of angiotensin converting enzyme (ACE; EC 3.4.15.1), the potentiation of bradykinin (BK) responses may also involve the BK receptor or some ...
-
Mixtures of trifluoroethanol or hexafluoroisopropanol and dimethylformamide are not of general applicability for peptide condensations catalyzed by trypsin
(Munksgaard Int Publ Ltd, 1998-01-01)Mixtures of a good hydrogen bond donor, 2,2,2-trifluoroethanol (TFE) or 1,1,1,3,3,3-hexafluroisopropanol, and an acceptor, dimethylformamide (DMF) (1:1,v/v), containing 4% buffer have been described as adequate solvent ...
-
Novel Copoly(Styrene-Divinylbenzene)-Resins with Different Phenylmethylamine Groups for Use in Peptide Synthesis Method
(Bentham Science Publ Ltd, 2015-01-01)Differently than the 4-methylbenzhydrylamine-resin (MBHAR) which contains a methyl group coupled to the phenylmethylamine-functionalized copoly(styrene-divinilbenzene) structure, alternative resins containing the ...
-
Reduction of ortho-aminobenzoyl-proline fluorescence and formation of pyrrolobenzodiazepine-5,11-dione
(Kluwer Academic Publ, 1998-01-01)The ortho-aminobenzoic acid (Abz) group is widely employed as a fluorescent marker for peptides used as substrates for the study of proteolytic enzyme activity. in fact, a direct correlation has been observed between ...
-
Resin selection based on the lability of peptidyl-resin linkage towards HF and TFA steps: Dependence on the C-terminal amino acid and peptide length
(Pharmaceutical Soc Japan, 1999-11-01)Ideally, the solid support used for teut-butyloxycarbonyl (Boc)-peptide synthesis method must allow sufficient stability of the peptide linkage towards TFA-alpha-amino deprotection but adequate lability to final HF cleavage. ...
