Low molecular weight squash trypsin inhibitors from Sechium edule seeds

Low molecular weight squash trypsin inhibitors from Sechium edule seeds

Autor Laure, H. J. Google Scholar
Faca, V. M. Google Scholar
Izumi, C. Google Scholar
Padovan, J. C. Google Scholar
Greene, L. J. Google Scholar
Instituição Universidade de São Paulo (USP)
Universidade Federal de São Paulo (UNIFESP)
Rockefeller Univ
Resumo Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. the components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. the inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. the sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriIlmeCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1: 1 stoichiometry and have dissociation constants of 5.4 x 10(-11) M and 1.1 x 10(-9) M, respectively. (c) 2005 Elsevier B.V. All rights reserved.
Assunto Sechium edule (Chuchu)
Cucurbitaceae
serine protease
squash trypsin inhibitor
amino acid sequence
trypsin activity
mass spectrometry
Idioma Inglês
Data 2006-02-01
Publicado em Phytochemistry. Oxford: Pergamon-Elsevier B.V., v. 67, n. 4, p. 362-370, 2006.
ISSN 0031-9422 (Sherpa/Romeo, fator de impacto)
Editor Elsevier B.V.
Extensão 362-370
Fonte http://dx.doi.org/10.1016/j.phytochem.2005.11.016
Direito de acesso Acesso restrito
Tipo Artigo
Web of Science WOS:000235450800005
URI http://repositorio.unifesp.br/handle/11600/28726

Mostrar registro completo




Arquivos deste item

Arquivos Tamanho Formato Visualização

Não existem arquivos associados a este item.

Este item aparece na(s) seguinte(s) coleção(s)