Primary structure, behavioral and electroencephalographic effects of an epileptogenic peptide from the sea anemone Bunodosoma cangicum.

Primary structure, behavioral and electroencephalographic effects of an epileptogenic peptide from the sea anemone Bunodosoma cangicum.

Author Cunha, R. B. Google Scholar
Santana, ANC Google Scholar
Amaral, P. C. Google Scholar
Carvalho, MDF Google Scholar
Carvalho, DMF Google Scholar
Cavalheiro, E. A. Google Scholar
Maigret, B. Google Scholar
Ricart, CAO Google Scholar
Cardi, B. A. Google Scholar
Sousa, M. V. Google Scholar
Carvalho, K. M. Google Scholar
Institution UECE
Universidade de Brasília (UnB)
Univ Nancy 1
Universidade Federal de São Paulo (UNIFESP)
Abstract The primary structure of cangitoxin (CGX), a 4958 Da peptide from the sea anemone Bunodosoma cangicum, was determined: GVACRCDSDGPTVRGNSLSGTLWLTGGCPSGWHNCRGSGPFIGYCCKK. CGX contains all the 11 residues that are conserved and the 5 that are conservatively substituted within or between the type 1 and type 2 sequences of se-a anemone peptides with specific action on voltage-sensitive sodium channels. Furthermore, it also has 6 identities (Asp9, Arg14, Asn16, Leu18, Trp33 and Lys48) and 1 homology (Arg36) in the 8 residues of the pharmacophore of the sea anemone ApB which are essential for interaction with mammalian sodium channels. the intrahippocampal injection of CGX induces several sequential behavioral alterations-episodes of akinesia alternating with facial automatisms and head tremor, salivation, rearing. jumping, barrel-rolling, wet dog shakes and forelimb clonic movements-and the electroencephalography analysis shows that they were followed by important seizure periods that gradually evolved to status epilepticus that lasted 8-12 h, similar to that observed in the acute phase of the pilocarpine model of epilepsy. These results suggest that CGX may be an important tool to develop a new experimental model of status epilepticus which may contribute to understanding the etiology of epilepsy and to test the effects of new antiepileptic drugs. (C) 2004 Elsevier B.V. All rights reserved.
Keywords Bunodosoma cangicum
cangitoxin
CGX
sea anemones
anemone peptides
seizure
electroencephalography
Language English
Date 2005-02-01
Published in Toxicon. Oxford: Pergamon-Elsevier B.V., v. 45, n. 2, p. 207-217, 2005.
ISSN 0041-0101 (Sherpa/Romeo, impact factor)
Publisher Elsevier B.V.
Extent 207-217
Origin http://dx.doi.org/10.1016/j.toxicon.2004.10.011
Access rights Closed access
Type Article
Web of Science ID WOS:000226716600010
URI http://repositorio.unifesp.br/handle/11600/28144

Show full item record




File

File Size Format View

There are no files associated with this item.

This item appears in the following Collection(s)

Search


Browse

Statistics

My Account