Primary structure, behavioral and electroencephalographic effects of an epileptogenic peptide from the sea anemone Bunodosoma cangicum.

Primary structure, behavioral and electroencephalographic effects of an epileptogenic peptide from the sea anemone Bunodosoma cangicum.

Autor Cunha, R. B. Google Scholar
Santana, ANC Google Scholar
Amaral, P. C. Google Scholar
Carvalho, MDF Google Scholar
Carvalho, DMF Google Scholar
Cavalheiro, E. A. Google Scholar
Maigret, B. Google Scholar
Ricart, CAO Google Scholar
Cardi, B. A. Google Scholar
Sousa, M. V. Google Scholar
Carvalho, K. M. Google Scholar
Instituição UECE
Universidade de Brasília (UnB)
Univ Nancy 1
Universidade Federal de São Paulo (UNIFESP)
Resumo The primary structure of cangitoxin (CGX), a 4958 Da peptide from the sea anemone Bunodosoma cangicum, was determined: GVACRCDSDGPTVRGNSLSGTLWLTGGCPSGWHNCRGSGPFIGYCCKK. CGX contains all the 11 residues that are conserved and the 5 that are conservatively substituted within or between the type 1 and type 2 sequences of se-a anemone peptides with specific action on voltage-sensitive sodium channels. Furthermore, it also has 6 identities (Asp9, Arg14, Asn16, Leu18, Trp33 and Lys48) and 1 homology (Arg36) in the 8 residues of the pharmacophore of the sea anemone ApB which are essential for interaction with mammalian sodium channels. the intrahippocampal injection of CGX induces several sequential behavioral alterations-episodes of akinesia alternating with facial automatisms and head tremor, salivation, rearing. jumping, barrel-rolling, wet dog shakes and forelimb clonic movements-and the electroencephalography analysis shows that they were followed by important seizure periods that gradually evolved to status epilepticus that lasted 8-12 h, similar to that observed in the acute phase of the pilocarpine model of epilepsy. These results suggest that CGX may be an important tool to develop a new experimental model of status epilepticus which may contribute to understanding the etiology of epilepsy and to test the effects of new antiepileptic drugs. (C) 2004 Elsevier B.V. All rights reserved.
Assunto Bunodosoma cangicum
sea anemones
anemone peptides
Idioma Inglês
Data 2005-02-01
Publicado em Toxicon. Oxford: Pergamon-Elsevier B.V., v. 45, n. 2, p. 207-217, 2005.
ISSN 0041-0101 (Sherpa/Romeo, fator de impacto)
Editor Elsevier B.V.
Extensão 207-217
Direito de acesso Acesso restrito
Tipo Artigo
Web of Science WOS:000226716600010

Mostrar registro completo

Arquivos deste item

Arquivos Tamanho Formato Visualização

Não existem arquivos associados a este item.

Este item aparece na(s) seguinte(s) coleção(s)