Purificação e caracterização de uma proteína procoagulante presente nas cerdas da lagarta Lonomia obliqua

Purificação e caracterização de uma proteína procoagulante presente nas cerdas da lagarta Lonomia obliqua

Alternative title Purification and characterization of a procoagulant protein from bristles of Lonomia obliqua caterpillar
Author Reis, Cleyson Valença Autor UNIFESP Google Scholar
Advisor Sampaio, Claudio Augusto Machado Autor UNIFESP Google Scholar
Abstract O objetivo deste estudo e a purificacao, caracterizacao e sequenciamento do N-terminal de um ativador de protrombina encontrado no veneno de Lonomia obliqua. Os extratos foram preparados pela maceracao em tampao salina-fosfato a frio e submetida a gel filtracao em Sephadex G75 em TRIS-HCl 50 mM, NaCl 100 mM, benzamidina 5mM pH8,0. A atividade das fracoes eluidas foram monitoradas pela capacidade de encurtar o tempo de recalcificacao do plasma humano. Apos dialise e concentracao, o pool das fracoes ativas fo i submetida a uma cromatografia de troca ionica (Resource Q) eluida com um gradiente linear (O-500 mM) ou submetida a uma fase reversa em HPLC (coluna C4) eluida com um gradiente linear de acetonitrila (O-IOO por cento ). Foi purificada uma proteina de 69 kDa com atividade procoagulante no fibrinogenio humano adicionado de fator 11. A proteina foi capaz de ativar fator II em ensaios com substrato cromogenico especifico, numa relacao de dose- dependencia, mas nao apresentou nenhuma atividade amidolitica. Esta ativacao fatores do complexo protrombina Fva e fosfolipidios), mas e potenciada por foi bloqueada pelo imunossoro especi fico produzido pelo 1. Butantan, PMSF, EDTA e ortofenantrolina. A sequencia N-terminal (DVVIDGACPDMKA VSKFDMNAYQGTWYEIKKFPVANEANGDCGSVE) apresenta 45 por cento de homologa com insecticianina (a) da hemolinfa de lagartas Manduca Sexta e de 48 por cento com um segmento interno de precurssores de apolipoprotelna D. Uma biblioteca de CDNA com um titulo de 108 pfu/gg DNA foi construida em um vetor lambda Zap (Stratagene) a partir de 9,1 mg de MRNA do extrato de cerdas de lagartas. A proteina isolada causa incoagulabilidade sa iiguinea em camundongos da mesma forma que o extrato bruto, sendo, provavelmente, responsavel pela forte atividade procoagulante nos pacientes com incoagulabllidade sanguinea
Keywords Protrombina
Language Portuguese
Date 1998
Published in São Paulo: [s.n.], 1998. 122 p.
Publisher Universidade Federal de São Paulo (UNIFESP)
Extent 122 p.
Access rights Closed access
Type Dissertation
URI http://repositorio.unifesp.br/handle/11600/15855

Show full item record


File Size Format View

There are no files associated with this item.

This item appears in the following Collection(s)




My Account